: strech=5 crowd_predictions=7 gap=45 itr=27 # parameters used for prediction and postprocessing length=110 # length of sequence 10 20 30 40 # position number 1234567890123456789012345678901234567890 # position number CPP=9 # number of positions predicted to bind a protein MQHPPCEPGNCLSLKEKKITEGSGGVCWGGETDASNPAPA # one letter sequence ---------------------------------------- # "-" for residue position predicted not to bind protein # "P" for a residue predicted to bind a protein. LTACCAAEREANVEQGLAGRLLLCNYERRLVRRCKIAGRG # ------------------------------PPPPPP-PPP # here, VRRCKI and GRG are predicted to bind protein. RAPLGTRPLDVSSFKLKEEGRPPCLKINK ----------------------------- 0 1 M -99 # raw svm output per position (without postprocessing). 2 Q 95 # negative score - unlikely to bind protein and vice versa 3 H -99 4 P -97 5 P -78 6 C -87 7 E -99 8 P -99 9 G -99 10 N 75 11 C -86 12 L -47 13 S 18 14 L 10 15 K 93 16 E -53 17 K -88 18 K -76 19 I -78 20 T -56 21 E -79 22 G -64 23 S -5 24 G -97 25 G 34 26 V 99 27 C -66 28 W 65 29 G -76 30 G 87 31 E 97 32 T 33 33 D -35 34 A -80 35 S -82 36 N 80 37 P -97 38 A -86 39 P -49 40 A -60 41 L -84 42 T -72 43 A 91 44 C -52 45 C -97 46 A -99 47 A -93 48 E 47 49 R -50 50 E -36 51 A -86 52 N 53 53 V -84 54 E 99 55 Q -80 56 G -43 57 L 4 58 A 69 59 G -34 60 R -82 61 L -99 62 L -13 63 L -70 64 C -60 65 N -99 66 Y 12 67 E -87 68 R -45 69 R 97 70 L -84 71 V 49 72 R 81 73 R 88 74 C 57 75 K 59 76 I 90 77 A 37 78 G 56 79 R 98 80 G 93 81 R 45 82 A 8 83 P 94 84 L 57 85 G -95 86 T 52 87 R -97 88 P -85 89 L -99 90 D -87 91 V 81 92 S 1 93 S -74 94 F -99 95 K -88 96 L -97 97 K -90 98 E -99 99 E 6 100 G -99 101 R -49 102 P 29 103 P -97 104 C -88 105 L -99 106 K -99 107 I 95 108 N -63 109 K 43