EVA results for 1wqk:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....,....4..
seq	GTTCYCGKTIGIYWFGTKTCPSNRGYTGSCGYFLGICCYPVD
dssp	--EEEE--EEEEEEE------------EEEEE--EEEEE---
mlrprdsec	--EEEE----EEEEEE--------------EEEEEEEEEE--	+2.7	+7.6	-0.09
phd	--EEE----EEEEEEE----------E-EE-EEEEEEEEE--	+6.3	+10.6	-0.05
phdpsi	--EEE----EEEEEEE----------E-EE-EEEEEEEEE--	+5.3	+9.7	-0.06
porter	---E-----EEEEEE-----------------EEEEEEE---	-1.9	-1.6	-0.19
prof_king	--EEEE----EEEEEEE-----------------EEEEE---	+6.0	+8.3	-0.04
profsec	-EE-------EEEEEE---------EEEE---EE-EEEE---	-11.0	+6.5	-0.29
psipred	--EE-------EEEEE---------EEEE---EEEEEEEE--	-9.5	+5.9	-0.28
sable	--EEE----EEEEEEE--------------EEEEEEEE----	+2.6	+7.6	-0.10
sable2	--EEE-----EEEEE---------------EEEEEEEE----	+1.7	+7.9	-0.10
samt99_sec	---E-----EEEEEEE---------------EEEEEEE----	-4.5	+1.1	-0.20
scratch	--EEE---EEEEEE------------------EEEEEE----	+0.6	+10.0	-0.11
sspro4	--EEE---EEEEEE------------------EEEEEE----	-2	+8.6	-0.14
yaspin	--EEEE---EEEEEEE-------------EEEEEEEEE---	+11.5	+11.9	-0.03

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)