EVA results for 1skh:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3
seq	MVKSKIGSWILVLFVAMWSDVGLCKKRPKP
dssp	--------HHHHHHHHHHHHH---------
phd	-------EEEEEEEEEEEE-----------	-18.8	-11.6	+0.22
phdpsi	-------EEEEEEEEEEEE-----------	-19.9	-12.6	+0.21
porter	-----HHHHHHHHHHHHHHH----------	+13.5	+15.4	+0.11
prof_king	--HHHH--EEEEEEEE--------------	-29.2	-30.5	+0.09
profsec	---------EEEEEHHHHHH----------	+1.4	+14.0	+0.24
psipred	----HHHHHHHHHHHHHHHH----------	+7.0	+19.8	+0.01
sable	-EE----HHHHHHHHHHH------------	+4.0	+1.4	+0.04
sable2	-EE----HHHHHHHHHHHH-----------	+6.4	+2.5	+0.09
samt99_sec	-----HHHHHHHHHHHHHHH----------	+10.7	+24.4	+0.09
scratch	--HHHHHHHHHHHHHHHHHH----------	+1.1	+9.6	-0.08
sspro4	--HHHHHHHHHHHHHHHHHH----------	-1.6	+8.3	-0.12
yaspin	--------EEEEEEEEE------------	-15.5	-15.9	+0.14
mlrprdsec	-------HHHHHHHHHHH------------	+11.2	+26.5	+0.08

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)