EVA results for 1s6x:A

Results

method	prediction	diff_Q3	diff_sov	diff_info
	....,....1....,....2....,....3....
seq	ECGKFMWKCKNSNDCCKDLVCSSRWKWCVLASPF
dssp	--E-----------E---EEEE----EEEE----
mlrprdsec	---EEEEEE-----HHHHHHHH---EEEEE----	-22.9	-14.0	-0.17
phd	-HHHHHHHH----------EE-----EEEEE---	-7.5	+2.4	-0.05
phdpsi	-HHHHHHHH----------EE-----EEEEE---	-8.6	+1.5	-0.06
porter	--------------------------EEEE----	+3.6	-27.5	-0.03
prof_king	---EEEEEE---------EEE---EEEEEE----	-4.9	+3.3	-0.22
profsec	-HHHHHHH-----------EEE---EEEEE----	-4.7	+2.7	-0.03
psipred	-----EEEE-----HHHHHHH-----EEEE----	-14.4	-21.6	-0.21
sable	----HHHH--------HHHHHH---EEEEEE---	-17.2	-21.1	-0.21
sable2	-------E--------HH--------EEEEE---	-6.4	-15.2	-0.25
samt99_sec	------------------EEE---EEEEE-----	+6.3	-0.1	-0.10
scratch	----EEEEE----------EE----EEEEE----	-5.1	-13.5	-0.27
sspro4	----EEEEE-----------E----EEEEE----	-10.6	-20.6	-0.34
yaspin	----EEEEE-----HHHHHHH-----EEEEE--	-17.1	-23.8	-0.27

DATE : date when added [yyyy_mm_dd]
TYPE : prediction category
COMPND : from PDB:DSSP: compound
SOURCE : from PDB:DSSP: organism asf
AUTHOR : from PDB:DSSP: authors of PDB structure
method : name of prediction method
prediction: actual prediction
diff_Q3 : Q3(this protein) - Q3(average over all proteins)
with: three-state per-residue accuracy (percentage of correctly predicted residues)
diff_sov : Sov3(this protein) - Sov3(average over all proteins)
with: three-state per-segment accuracy (percentage of segment overlap)
diff_info : info(this protein) - info(average over all proteins)
with: info=(infoO + infoP)/2information index accuracy (percentage of observed)
and with: infoO=information index accuracy (percentage of observed)
and with: infoP=information index accuracy (percentage of predicted)